PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold02009-augustus-gene-0.25-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 256aa    MW: 27400.7 Da    PI: 4.644
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold02009-augustus-gene-0.25-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70285.61.2e-2612217799154
                                         DUF702  99 eletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                                     le  ++P+ev+s+avfrcvrvs+++d +e++aYqtavsigGhvfkGiLydqG+e+
  maker-scaffold02009-augustus-gene-0.25-mRNA-1 122 GLELGQFPAEVNSPAVFRCVRVSAMEDPDEQYAYQTAVSIGGHVFKGILYDQGPED 177
                                                    567789************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-24105176IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.6E-27127175IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MAGLFYLGGR EGSHNKQEEE EEKQENNSNS LYLYRNEEIY NHNSSSNNKG FELWPQQQYY  60
PPQQNLSNFY SFGVGPSSRR ISNHNLNDVS DHHESSRSGF TLMRQGGLGG LGGGGMNCQD  120
CGLELGQFPA EVNSPAVFRC VRVSAMEDPD EQYAYQTAVS IGGHVFKGIL YDQGPEDRYT  180
TGGEISSGGG SGGGGGGGGT QPLNLITAGT TSTNVTTAST SNNPTTTTTL LDPSSLFPAP  240
INAFMAGTQF FPPPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186199SGGGSGGGGGGGGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007046785.13e-46Lateral root primordium protein-related, putative
SwissprotQ9XGX04e-38SHI_ARATH; Protein SHORT INTERNODES
SwissprotQ9SD401e-37SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A061DFV64e-46A0A061DFV6_THECC; Lateral root primordium protein-related, putative
TrEMBLA0A0K9R9416e-46A0A0K9R941_SPIOL; Uncharacterized protein
STRINGPOPTR_0007s13610.16e-43(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-31Lateral root primordium (LRP) protein-related